Gene 84963.m00150 (T.vaginalis)

84963.m00150

Species: T.vaginalis
Alias: TvagK0815, 84963.m00150
External Links:
Annotation:

Classification

Group: PKL
Family: PIK
Subfamily: PI3K

Sequence

Name Sequence Type Origin Length Description Download
84963.m00150.AA Protein None 95 None Fasta, JSON
84963.m00150.kin_dom Protein Kinase Domain None 94 None Fasta, JSON

Protein domain

Protein domains of 84963.m00150.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
PI3_PI4_kinase 84963.m00150.AA PI3_PI4_kinase 1-92 25 1.8e-14 55.18 Pfam 177-295 (300) Show / Hide 
Range on Protein: 1-92
Range on HMM: 177-295/300
Sequence Identity: 25% (30 aa)

MTYLLKFGDRHDNNIIV---IRDGHLLHIDYGFILG-----DVNKSFTPPVKLFR------EMVDII------DPENGLQEICDWICSTFNSLRNRARLI
..|.|  |||| .|| |     .||| |||.|....       .| ...| .. .      .||. .      ||    .. .|  ......||  ..|.
VDYILGNGDRHNDNIMVKDDKTTGHLFHIDFGHCFPHWKMKHFHKPERVPFRWTHWPQAKKPMVHAMGGYISLDPSGDYGWFRDYCWHAYRALRRHMNLC

LVLI-------ELMFTAPL
. |.       |.|....|
MNLLKKAVMRGECMVHDGL