Gene 33995 (M.brevicollis)

33995

Species: M.brevicollis
Alias: 33995
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: SH2-R

Sequence

Name Sequence Type Origin Length Description Download
33995.AA Protein None 1106 None Fasta, JSON

Protein domain

Protein domains of 33995.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
TNFR 33995.AA TNFR 184-222 24 0.000446 20.79 SMART 1-50 (50) Show / Hide 
Range on Protein: 184-222
Range on HMM: 1-50/50
Sequence Identity: 24% (12 aa)

CG--SNHYLLPDG-----LSCNRYR-EPCMD---GESLLAAGTPTSDRVC
|    .||  . .       | . |  .|     |..... .|.||..||
CKCQEGHYCHHWNHTHYEPHCLPCRHTRCPPEHMGQYMKQPCTATSNTVC
SH2 33995.AA SH2 519-609 34 6.6e-14 53.44 SMART 1-87 (87) Show / Hide 
Range on Protein: 519-609
Range on HMM: 1-87/87
Sequence Identity: 34% (32 aa)

QPWMMGIVSARRVEFLLGN--QTDGAFCVRVSAH-NLCLVLNVSWNGSVWHFPIEMDDELDEMEHGYRIYEVGTDFFFPTLESMIDYHMQEPLL
||| .| .|   .| || |  . ||.| || | . . ..|| | |.| | |. |. .|.      .|.| |  ..  ||.|  ....... || 
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDD-----GKYYIDET-WRRKFPSL-ELVNHYQHNPLG
SH2 33995.AA SH2 521-603 28 3.1e-05 17.18 Pfam 1-81 (81) Show / Hide 
Range on Protein: 521-603
Range on HMM: 1-81/81
Sequence Identity: 28% (25 aa)

WMMGIVSARRVEFLLGN--QTDGAFCVRVSAHNL-CLVLNVSWNG---SVWHFPIEMDDELDEMEHGYRIYEVGTDFFFPTLESMIDYH
| .| .|   .| || |  ..||.| || |  .  . .| | ..|   .| |. |  .|.      || |..  .   |..|  .....
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNG-----GYYITGRHK---FCSLQELVEHY