Gene N10 (M.brevicollis)

N10

Species: M.brevicollis
Alias: N10
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
N10.AA Protein None 102 None Fasta, JSON

Protein domain

Protein domains of N10.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 N10.AA SH2 1-89 33 3.3e-20 74.39 SMART 1-87 (87) Show / Hide 
Range on Protein: 1-89
Range on HMM: 1-87/87
Sequence Identity: 33% (30 aa)

QEWYHGPITRGDVVRLLKRDDGGWDGWFLLRLSTKEAHTFVLSLCYKGKLYHNQVKFEN-DMYNTHRDQGNHQYKTLSELIKHHKADRNG
|.||||.|.| ....|||.  |. || ||.| | ...  .|||...||| .| ... .. ..|    . ..... .| ||. |..  . |
QPWYHGNISREEAEQLLKNP-GMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDET-WRRKFPSL-ELVNHYQHNPLG
SH2 N10.AA SH2 3-83 31 8.3e-19 57.04 Pfam 1-81 (81) Show / Hide 
Range on Protein: 3-83
Range on HMM: 1-81/81
Sequence Identity: 31% (27 aa)

WYHGPITRGDVVRLLKRDDGGWDGWFLLRLSTKEAHTFVLSLCYKG---KLYHNQVKFENDM--YNTHRDQGNHQYKTLSELIKHH
||||.|.| .. |||.   |. || ||.| |  .   ..||....|   . .| ........  | | |..    . .|.||. |.
WYHGKISRQEAERLLMN-PGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHK----FCSLQELVEHY