Gene 30978 (M.brevicollis)

30978

Species: M.brevicollis
Alias: 30978
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
30978.AA Protein None 552 None Fasta, JSON

Protein domain

Protein domains of 30978.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 30978.AA SH2 167-251 27 1.7e-15 58.75 SMART 6-87 (87) Show / Hide 
Range on Protein: 167-251
Range on HMM: 6-87/87
Sequence Identity: 27% (24 aa)

GVIPRRVASNVLLQ--HKPGTYLLRARSDGRMGLVLAVRQHDHVAHYLICDDGSNNSFRLFSHHNSNMPSFPSLKNLIDYYKVHPIG
| |.|  | . |..   ..|..|.| ..  . ..|| || ...| ||.|. ... .....  .   . ..||||  |...|. .|.|
GNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDD-GKYYIDET---WRRKFPSL-ELVNHYQHNPLG
SH2 30978.AA SH2 167-245 25 7e-07 22.03 Pfam 4-81 (81) Show / Hide 
Range on Protein: 167-245
Range on HMM: 4-81/81
Sequence Identity: 25% (21 aa)

GVIPRRVASNVLLQ--HKPGTYLLRARSDGRMGLVLAVRQHD---HVAHYLICDDGSNNSFRLFSHHNSNMPSFPSLKNLIDYY
| |.|  | . |..   ..||.|.| ..    . .| ||  .   .| || |. ..         .  .  . |.||  |...|
GKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNG------GYYITGRHKFCSLQELVEHY
FYVE 30978.AA FYVE 334-398 31 1.5e-16 59.27 Pfam 1-71 (71) Show / Hide 
Range on Protein: 334-398
Range on HMM: 1-71/71
Sequence Identity: 31% (23 aa)

ERWVPDGDADVCQCCQATQFGTL--KRRHHCRSCGHVIA--GCCVSGAIHV-----QDIQLEKVCRDCFAKLQP
 .|.|| ....|..||.  | |.  .||||||.||..    . | |  . .     .. . ..||. |...||.
PHWQPDSEVTHCMICQK-PF-TFFGRRRHHCRHCGRIFCDDSKCSSHKCIPHPPYYGWNKPVRVCD-CYDDLQK
FYVE 30978.AA FYVE 331-398 25 1.1e-15 59.3 SMART 1-81 (81) Show / Hide 
Range on Protein: 331-398
Range on HMM: 1-81/81
Sequence Identity: 25% (21 aa)

MPVERWVPDGDADVC-QCCQATQFGT-LKRRHHCRSCGHVIAGCCVSGAIHVQDIQ------------LEKVCRDCFAKLQP
.  ..|.||  .|.| . |  ..|.  ..|||||| ||... . |..  |.... .              .||.||..... 
ETKPHWQPDEEVDHCCMNC-RKEFNFVTNRRHHCRHCGRIFCSKCCNKWIPLPYMGNYKKNGNNQNFTPVRVCDDCYEMMHH