31044

Species: M.brevicollis
Alias: 31044
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
31044.AA Protein None 1160 None Fasta, JSON

Protein domain

Protein domains of 31044.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 31044.AA SH2 8-92 29 4e-16 60.8 SMART 1-87 (87) Show / Hide
Range on Protein: 8-92
Range on HMM: 1-87/87
Sequence Identity: 29% (26 aa)

EEWFAGLQDKHSIEQRLMQPGVADGSFVLRSSASDPNAFTMVVRWQGALKNFRIFQQN-YLWHVSP--TIGYPSLGALVHTHIADGIA
..|. |  ...  || |..||  ||.|..| | |.|....  |||.|  |..||....   ...       .|||  ||. .    . 
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDETWRRKFPSL-ELVNHYQHNPLG

SH2 31044.AA SH2 10-86 30 5.4e-11 34.11 Pfam 1-81 (81) Show / Hide
Range on Protein: 10-86
Range on HMM: 1-81/81
Sequence Identity: 30% (25 aa)

WFAGLQDKHSIEQRLMQPGVADGSFVLRSSASDPNAFTMVVRWQG---ALKNFRIFQQNYL-WHVSPTIGYPSLGALVHTH
|. |   ..  |..||.||  ||.|..| | | |. .|  ||..|     | .|| ...   . ..    ..||  ||. .
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHKFCSLQELVEHY