Gene n1215 (Tetrahymena)

n1215

Species: Tetrahymena
Alias: n1215, 1669.m00002, 1215
External Links:
Annotation:

Classification

Group: Other
Family: Ciliate-C7

Sequence

Name Sequence Type Origin Length Description Download
n1215.AA Protein None 260 None Fasta, JSON
n1215.NA RNA None 780 None Fasta, JSON
n1215.kin_dom Protein Kinase Domain None 34 None Fasta, JSON

Protein domain

Protein domains of n1215.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase n1215.AA Ciliate-C7 1-23 65 1.3e-09 27.5 In-house 142-164 (164) Show / Hide 
Range on Protein: 1-23
Range on HMM: 142-164/164
Sequence Identity: 65% (15 aa)

KIADFGLADNLINKSGYAMNQYM
...||||||||..||.|..||||
VVCDFGLADNLTQKSKYQINQYM
Kinase n1215.AA CZAK 1-34 44 6.9e-05 13.86 In-house 162-194 (279) Show / Hide 
Range on Protein: 1-34
Range on HMM: 162-194/279
Sequence Identity: 44% (15 aa)

KIADFGLADNLINKSGYAMNQYMGNFLYQAPECF
||.||||   .    .  | | ||   ..|||||
KINDFGLS-REMMEQPFEMTQTMGCLCWMAPECF