Gene CC1G_09799 (C.cinerea)
CC1G_09799
Species: C.cinerea
Alias: CC1G_09799
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CC1G_09799.AA | Protein | None | 383 | None | Fasta, JSON |
CC1G_09799.NA | RNA | None | 1152 | None | Fasta, JSON |
CC1G_09799.kin_dom | Protein Kinase Domain | None | 193 | None | Fasta, JSON |
Protein domains of CC1G_09799.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | CC1G_09799.AA | CDC2 | 212-234 | 56 | 3.9e-09 | 23.66 | In-house | 111-133 (301) | Show / Hide |
Range on Protein: 212-234 Range on HMM: 111-133/301 Sequence Identity: 56% (13 aa) QLLEGLVFLHEKRIAHRDIAPQN |.|.|. |.| .|| |||. ||| QILQGVHFCHQRRIMHRDLKPQN |
|||||||||
Kinase | CC1G_09799.AA | CDK-Unclassified | 212-234 | 60 | 2.1e-08 | 23.64 | In-house | 129-151 (324) | Show / Hide |
Range on Protein: 212-234 Range on HMM: 129-151/324 Sequence Identity: 60% (14 aa) QLLEGLVFLHEKRIAHRDIAPQN |.|||...||.. | |||| ||| QMLEGIAYLHCNKIMHRDIKPQN |
|||||||||
Kinase | CC1G_09799.AA | GSK | 212-234 | 56 | 3.1e-08 | 20.64 | In-house | 124-146 (328) | Show / Hide |
Range on Protein: 212-234 Range on HMM: 124-146/328 Sequence Identity: 56% (13 aa) QLLEGLVFLHEKRIAHRDIAPQN |.. || .||.. |.|||| ||| QMFRGLAYLHSHGICHRDIKPQN |
|||||||||
Kinase | CC1G_09799.AA | DAPK | 212-239 | 46 | 1.1e-07 | 16.93 | In-house | 111-138 (264) | Show / Hide |
Range on Protein: 212-239 Range on HMM: 111-138/264 Sequence Identity: 46% (13 aa) QLLEGLVFLHEKRIAHRDIAPQNTVLNS | |||. .|| ..|.| |. ||| | . QILEGVHYLHSRNICHLDLKPQNIMLTD |
|||||||||
Kinase | CC1G_09799.AA | CDK | 212-234 | 56 | 1.3e-07 | 20.22 | In-house | 116-138 (284) | Show / Hide |
Range on Protein: 212-234 Range on HMM: 116-138/284 Sequence Identity: 56% (13 aa) QLLEGLVFLHEKRIAHRDIAPQN |||.|| ..|...| |||. ||| QLLRGLHYCHSNWIMHRDLKPQN |
|||||||||
Kinase | CC1G_09799.AA | DRAK | 212-239 | 50 | 1.6e-07 | 18.82 | In-house | 107-134 (259) | Show / Hide |
Range on Protein: 212-239 Range on HMM: 107-134/259 Sequence Identity: 50% (14 aa) QLLEGLVFLHEKRIAHRDIAPQNTVLNS | |||. .||.. |.| | ||| | | QILEGVHYLHQRNIVHLDLKPQNILLTS |
|||||||||
Kinase | CC1G_09799.AA | CDK4 | 209-239 | 51 | 1.7e-07 | 21.55 | In-house | 115-145 (290) | Show / Hide |
Range on Protein: 209-239 Range on HMM: 115-145/290 Sequence Identity: 51% (16 aa) LADQLLEGLVFLHEKRIAHRDIAPQNTVLNS . ||| |. ||| || ||| ||| ..| MMHQLLRGVDFLHSHRIIHRDLKPQNILVTS |
|||||||||
Kinase | CC1G_09799.AA | CDK5 | 212-238 | 55 | 4.1e-07 | 17.99 | In-house | 106-132 (287) | Show / Hide |
Range on Protein: 212-238 Range on HMM: 106-132/287 Sequence Identity: 55% (15 aa) QLLEGLVFLHEKRIAHRDIAPQNTVLN ||| || | ||... ||| ||| | QLLKGLAFCHEHHVLHRDLKPQNLLIN |
|||||||||
Kinase | CC1G_09799.AA | CMGC | 212-239 | 37 | 5.4e-07 | 18.02 | In-house | 188-219 (513) | Show / Hide |
Range on Protein: 212-239 Range on HMM: 188-219/513 Sequence Identity: 37% (12 aa) QLLEGLV--FLHEKR--IAHRDIAPQNTVLNS |.|.|| ..| .. | |||. |.| .|. QILRGLKLKYCHSHWGNIIHRDLKPENILINH |
|||||||||
Kinase | CC1G_09799.AA | STE-Unique | 203-239 | 33 | 1e-06 | 19.17 | In-house | 402-440 (616) | Show / Hide |
Range on Protein: 203-239 Range on HMM: 402-440/616 Sequence Identity: 33% (13 aa) AEQLFILADQLLEGLVFLHEKR--IAHRDIAPQNTVLNS ... . .. |.||||..|| .. | |||. | | .... ETEVIWYTYQILEGLEYLHSQHNPIIHRDLKPHNIFCMQ |
|||||||||
Kinase | CC1G_09799.AA | Pkinase | 212-230 | 47 | 0.000936 | 14.36 | Pfam | 116-134 (293) | Show / Hide |
Range on Protein: 212-230 Range on HMM: 116-134/293 Sequence Identity: 47% (9 aa) QLLEGLVFLHEKRIAHRDI |.|.|| ..|...| |||. QILRGLEYCHSMGIIHRDL |