Gene CC1G_09797 (C.cinerea)
CC1G_09797
Species: C.cinerea
Alias: CC1G_09797
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CC1G_09797.AA | Protein | None | 380 | None | Fasta, JSON |
CC1G_09797.NA | RNA | None | 1143 | None | Fasta, JSON |
CC1G_09797.kin_dom | Protein Kinase Domain | None | 290 | None | Fasta, JSON |
Protein domains of CC1G_09797.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | CC1G_09797.AA | nmo | 189-226 | 44 | 3.6e-07 | 17.46 | In-house | 100-137 (292) | Show / Hide |
Range on Protein: 189-226 Range on HMM: 100-137/292 Sequence Identity: 44% (17 aa) SVEHIFDMLEQFYDGLAFLHDNRIAHRDIDPGNMVMNA | .|. | | || .|| .| |||| |||...|. SSDHVKVFLYQILRGLKYLHSANILHRDIKPGNLLVNS |
|||||||||
Kinase | CC1G_09797.AA | Ciliate-A1 | 191-225 | 37 | 5.5e-07 | 19.76 | In-house | 101-135 (301) | Show / Hide |
Range on Protein: 191-225 Range on HMM: 101-135/301 Sequence Identity: 37% (13 aa) EHIFDMLEQFYDGLAFLHDNRIAHRDIDPGNMVMN | | ... |. |.| .|| | |||. |.| ... EEIYEICYQIIEGYADIHDHNILHRDLKPQNILIH |
|||||||||
Kinase | CC1G_09797.AA | IRE | 195-221 | 40 | 9.4e-07 | 18.98 | In-house | 120-146 (292) | Show / Hide |
Range on Protein: 195-221 Range on HMM: 120-146/292 Sequence Identity: 40% (11 aa) DMLEQFYDGLAFLHDNRIAHRDIDPGN ... | .||..||. | |||. | | QLIKQCMNGLQHLHSQNIVHRDLKPHN |
|||||||||
Kinase | CC1G_09797.AA | MST | 203-225 | 56 | 3e-06 | 15.65 | In-house | 109-131 (254) | Show / Hide |
Range on Protein: 203-225 Range on HMM: 109-131/254 Sequence Identity: 56% (13 aa) GLAFLHDNRIAHRDIDPGNMVMN ||. ||||.. |||| .|| .| GLQYLHDNKKIHRDIKAGNILLN |
|||||||||
Kinase | CC1G_09797.AA | CDK4 | 189-225 | 37 | 5e-06 | 16.44 | In-house | 108-144 (290) | Show / Hide |
Range on Protein: 189-225 Range on HMM: 108-144/290 Sequence Identity: 37% (14 aa) SVEHIFDMLEQFYDGLAFLHDNRIAHRDIDPGNMVMN . . | .| |. |. ||| .|| ||| | |. . PPCTIKHMMHQLLRGVDFLHSHRIIHRDLKPQNILVT |
|||||||||
Kinase | CC1G_09797.AA | MEKK1 | 198-224 | 48 | 5e-06 | 17.98 | In-house | 109-135 (266) | Show / Hide |
Range on Protein: 198-224 Range on HMM: 109-135/266 Sequence Identity: 48% (13 aa) EQFYDGLAFLHDNRIAHRDIDPGNMVM .| ||..||||.| |||. |. | HQVCRGLSYLHDNQIIHRDVKGANLLM |
|||||||||
Kinase | CC1G_09797.AA | CDK-Unclassified | 196-221 | 50 | 6e-06 | 15.53 | In-house | 126-151 (324) | Show / Hide |
Range on Protein: 196-221 Range on HMM: 126-151/324 Sequence Identity: 50% (13 aa) MLEQFYDGLAFLHDNRIAHRDIDPGN .. |. |.|.|| | | |||| | | FMHQMLEGIAYLHCNKIMHRDIKPQN |
|||||||||
Kinase | CC1G_09797.AA | LKB | 199-222 | 50 | 1.2e-05 | 12.85 | In-house | 112-135 (265) | Show / Hide |
Range on Protein: 199-222 Range on HMM: 112-135/265 Sequence Identity: 50% (12 aa) QFYDGLAFLHDNRIAHRDIDPGNM | ||. .|| |. |.|| |||. QLCDGCEYLHSQRVVHKDIKPGNL |
|||||||||
Kinase | CC1G_09797.AA | CMGC | 203-225 | 37 | 1.7e-05 | 12.98 | In-house | 192-218 (513) | Show / Hide |
Range on Protein: 203-225 Range on HMM: 192-218/513 Sequence Identity: 37% (10 aa) GLA--FLHDNR--IAHRDIDPGNMVMN ||. ..| .. | |||. | | .| GLKLKYCHSHWGNIIHRDLKPENILIN |
|||||||||
Kinase | CC1G_09797.AA | Ste20-DD1 | 191-227 | 45 | 1.9e-05 | 14.38 | In-house | 107-143 (268) | Show / Hide |
Range on Protein: 191-227 Range on HMM: 107-143/268 Sequence Identity: 45% (17 aa) EHIFDMLEQFYDGLAFLHDNRIAHRDIDPGNMVMNAL | | . | || .|| ||| |||| || .| . EQIAAICYQIVKGLVYLHSNRITHRDIKAGNVLVNKE |