CC1G_07447

Species: C.cinerea
Alias: CC1G_07447
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07447.AA Protein None 980 None Fasta, JSON
CC1G_07447.NA RNA None 2943 None Fasta, JSON
CC1G_07447.kin_dom Protein Kinase Domain None 487 None Fasta, JSON

Protein domain

Protein domains of CC1G_07447.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07447.AA MAPKAPK 644-699 40 8.7e-08 19.71 In-house 126-182 (292) Show / Hide
Range on Protein: 644-699
Range on HMM: 126-182/292
Sequence Identity: 40% (24 aa)

HRDLSPGNILAARTSANGPWQVKLSDLEYAKR--FPSDY-SPSSTPKTASPHFLAYEVA
|||| | |||   |. | |  |||.|.  ||.  . .|. .|..||. ..|.. .| .|
HRDLKPENILCTDTNHNCP--VKLCDFGFAKEIHLNHDCTTPITTPELMTPCYTPYYMA

Kinase CC1G_07447.AA IRE 643-670 38 0.00015 11.22 In-house 138-168 (292) Show / Hide
Range on Protein: 643-670
Range on HMM: 138-168/292
Sequence Identity: 38% (12 aa)

VHRDLSPGNILAAR--TSANG-PWQVKLSDL
||||| | |||      ...|    ...||.
VHRDLKPHNILIHMNRPNQHGENNRFMISDF

Kinase CC1G_07447.AA TTBKL 630-652 43 0.000504 9.56 In-house 111-133 (288) Show / Hide
Range on Protein: 630-652
Range on HMM: 111-133/288
Sequence Identity: 43% (10 aa)

CVLALRVMFCAGWVHRDLSPGNI
|. ||. |  .|..|||. |.|.
CLYALKQMHDCGFIHRDVKPCNC

Kinase CC1G_07447.AA MNK 623-691 30 0.000899 8.85 In-house 100-172 (292) Show / Hide
Range on Protein: 623-691
Range on HMM: 100-172/292
Sequence Identity: 30% (23 aa)

AMDILKGCVLALRVMFCAGWVHRDLSPGNILAARTSANGPWQVKLSDLEYAKR-----FPSDY-SPSSTPKTASP
|  . |   .||  |   |  |||| | |||   .    |  ||. |.. .       . .|. .| .||  ..|
ASQVIKDIASALDFMHNKGIAHRDLKPENILCEHPNHVCP--VKICDFDLGSGRPPIHLNHDCSQPITTPELLTP