Gene AqueK122 (A.queenslandica)
AqueK122
Species: A.queenslandica
Alias: AqueK122
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
AqueK122.AA | Protein | None | 179 | None | Fasta, JSON |
AqueK122.kin_dom | Protein Kinase Domain | None | 57 | None | Fasta, JSON |
Protein domains of AqueK122.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | AqueK122.AA | ERK7 | 3-60 | 67 | 2.1e-28 | 94.0 | In-house | 84-140 (292) | Show / Hide |
Range on Protein: 3-60 Range on HMM: 84-140/292 Sequence Identity: 67% (39 aa) NTDLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSECFIK .|||||||. | .| .| |||| || | .||.||||||||||||||||..|||..| ETDLHAVIR-KGNILKDIHKQYIMYQLLRAIKYMHSGNVIHRDLKPSNILLDSECMVK |
|||||||||
Kinase | AqueK122.AA | MAPK | 4-60 | 61 | 1.2e-26 | 89.03 | In-house | 100-157 (328) | Show / Hide |
Range on Protein: 4-60 Range on HMM: 100-157/328 Sequence Identity: 61% (36 aa) TDLHAVIKSKIPVL*SVHMQYIMSQLCRV--LKYIHSGNVIHRDLKPSNILINSECFIK ||||..||| | |.||.| |..| ||||||.|||||||||||||.|..| | TDLHQIIKSQQ-PLSDDHIQYFMYQILRGLKLKYIHSANVIHRDLKPSNILVNENCDLK |
|||||||||
Kinase | AqueK122.AA | CMGC | 1-57 | 32 | 3.3e-20 | 62.26 | In-house | 136-221 (513) | Show / Hide |
Range on Protein: 1-57 Range on HMM: 136-221/513 Sequence Identity: 32% (28 aa) LINTDLHAVIKS--------KIPVL*SVH------------MQYIM------SQLCRVLK--YIHSGN--VIHRDLKPSNILINSEC .. .||. .||. . | | .|.| |..| || |.|| . .|||||||.|||||..| YMDHDLYQYIKNNQFDYQGKRPMPLSE-HENKHPHRRPPHNIKYFMIHIRYMYQILRGLKLKYCHSHWGNIIHRDLKPENILINHNC |
|||||||||
Kinase | AqueK122.AA | MAPK-Unclassified | 1-60 | 47 | 5.9e-20 | 68.45 | In-house | 87-149 (575) | Show / Hide |
Range on Protein: 1-60 Range on HMM: 87-149/575 Sequence Identity: 47% (30 aa) LINT---DLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSECFIK . | ||| .||| . . | ||.. |. | |||.|| ..|||||||||.||| | .. YMQTSLFDLHQIIKSNQDHWCHQHIQYFFYQILRGLKYLHSACIIHRDLKPSNLLINQDCSVR |
|||||||||
Kinase | AqueK122.AA | ERK | 1-57 | 61 | 2.1e-19 | 69.01 | In-house | 90-145 (307) | Show / Hide |
Range on Protein: 1-57 Range on HMM: 90-145/307 Sequence Identity: 61% (35 aa) LINTDLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSEC |. |||| .|.|. | | || | |. . |||||| |||||||||||||.|| | LMETDLHQIINSQQ-ELSDDHCQYFMYQILCGLKYIHSANVIHRDLKPSNILVNSNC |
|||||||||
Kinase | AqueK122.AA | p38 | 1-57 | 45 | 6.5e-17 | 54.07 | In-house | 89-143 (289) | Show / Hide |
Range on Protein: 1-57 Range on HMM: 89-143/289 Sequence Identity: 45% (26 aa) LINTDLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSEC . .||. ..|.. | | |.. |. | |||||| ..|||||||||| .| .| FMGADLNNIMKCQR--LSDDHIQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDC |
|||||||||
Kinase | AqueK122.AA | ERK5 | 1-60 | 50 | 1.6e-16 | 56.98 | In-house | 85-143 (295) | Show / Hide |
Range on Protein: 1-60 Range on HMM: 85-143/295 Sequence Identity: 50% (30 aa) LINTDLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSECFIK |. ||| .| | | . |. | . |. | |||.|| .||||||||||.|.| | .| LMESDLHQIIHSNQP-FTLEHIRYFLYQILRGLKYMHSAQVIHRDLKPSNLLVNENCELK |
|||||||||
Kinase | AqueK122.AA | ERK3 | 21-56 | 66 | 2.5e-16 | 48.69 | In-house | 111-146 (300) | Show / Hide |
Range on Protein: 21-56 Range on HMM: 111-146/300 Sequence Identity: 66% (24 aa) HMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSE | . | || | |||||| || |||||| ||.|| | HARLFMYQLLRGLKYIHSANVLHRDLKPANIFINTE |
|||||||||
Kinase | AqueK122.AA | ERK1 | 1-60 | 50 | 1.2e-14 | 51.29 | In-house | 83-140 (289) | Show / Hide |
Range on Protein: 1-60 Range on HMM: 83-140/289 Sequence Identity: 50% (30 aa) LINTDLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSECFIK |. ||| ..|.. | |. | . |. | |||||| ||.||||||||.|.| | .| LMETDLYKLLKTQ--HLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLK |
|||||||||
Kinase | AqueK122.AA | nmo | 1-60 | 46 | 1.8e-14 | 40.3 | In-house | 84-142 (292) | Show / Hide |
Range on Protein: 1-60 Range on HMM: 84-142/292 Sequence Identity: 46% (28 aa) LINTDLHAVIKSKIPVL*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSECFIK |. ||| .| | . | | |.. . |. | |||.|| |..|||.|| |.|.||.| .| LMQSDLHKIIVSPQH-LSSDHVKVFLYQILRGLKYLHSANILHRDIKPGNLLVNSNCVLK |
|||||||||
Kinase | AqueK122.AA | Pkinase | 3-60 | 33 | 8e-14 | 49.95 | Pfam | 84-152 (293) | Show / Hide |
Range on Protein: 3-60 Range on HMM: 84-152/293 Sequence Identity: 33% (23 aa) NT----DLHAVIK--SKIPV-L*SVHMQYIMSQLCRVLKYIHSGNVIHRDLKPSNILINSECFI----K .. ||...|. .. .. . . . .| |..| |.|.|| ..|||||||.||||.... | | GGLYVMDLFDYISTWRHGCFYFSEWECKFYMYQILRGLEYCHSMGIIHRDLKPENILIDNNGHIDACVK |
|||||||||
Kinase | AqueK122.AA | ERK7 | 134-179 | 41 | 1.4e-14 | 45.96 | In-house | 204-249 (292) | Show / Hide |
Range on Protein: 134-179 Range on HMM: 204-249/292 Sequence Identity: 41% (19 aa) RPLYPGSSTINQLNRIMSTLPPPSRQDVESIKSPYAKAILDQIIHK .|..||.||.||...|. |.| |...|.|.|.| || .|.|.... KPMFPGTSTMNQIEKILETIPKPTQEDIEAIGSHYAWNMLEQMNQQ |
|||||||||
Kinase | AqueK122.AA | MAPK | 134-173 | 36 | 8.9e-10 | 29.76 | In-house | 232-272 (328) | Show / Hide |
Range on Protein: 134-173 Range on HMM: 232-272/328 Sequence Identity: 36% (15 aa) RPLYPGSSTINQLNRIMSTLPPPSRQDVESIK-SPYAKAIL .|| ||...|.|.|.||..|. ||..... |. |. |. . KPLFPGKDYIDQWNLIMEVLGTPSEEFIQCICMSEHARNYI |
|||||||||
Kinase | AqueK122.AA | CMGC | 134-168 | 22 | 6.7e-05 | 11.02 | In-house | 340-401 (513) | Show / Hide |
Range on Protein: 134-168 Range on HMM: 340-401/513 Sequence Identity: 22% (14 aa) RPLYP-----------GSSTINQLNRIMSTLPPP----------------SRQDVESIKSPY .|| | |.|.|.||..|. .| .| .... . || |. KPLFPGHSEYPNDDKNGKSHIDQLFKIFKVLGTPTWMIQKGKRHFNFCKHEEEWPNMIKLPW |
|||||||||
Kinase | AqueK122.AA | ERK1 | 134-179 | 36 | 0.000102 | 13.63 | In-house | 201-246 (289) | Show / Hide |
Range on Protein: 134-179 Range on HMM: 201-246/289 Sequence Identity: 36% (17 aa) RPLYPGSSTINQLNRIMSTLPPPSRQDVESIKSPYAKAILDQIIHK ||..|| . ||| |.. | ||..|.. | |.. | . || RPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINEKARNYLQSLPHK |
|||||||||
Kinase | AqueK122.AA | p38 | 134-173 | 35 | 0.000758 | 8.71 | In-house | 201-240 (289) | Show / Hide |
Range on Protein: 134-173 Range on HMM: 201-240/289 Sequence Identity: 35% (14 aa) RPLYPGSSTINQLNRIMSTLPPPSRQDVESIKSPYAKAIL |.|.||. |.||.|||. . |.. .. |.| |.. . RTLFPGDDHIDQLQRIMKVCGTPDEEFWQKIQSEEARNYI |
|||||||||
Kinase | AqueK122.AA | ERK | 134-170 | 36 | 0.001496 | 9.32 | In-house | 214-251 (307) | Show / Hide |
Range on Protein: 134-170 Range on HMM: 214-251/307 Sequence Identity: 36% (14 aa) RPLYPGSSTINQLNRIMSTLPPP-SRQDVESIKSPYAK .|| || ....|.||| ... | | .|.. |.|. |. KPLFPGKDYVHQINRIFQIIGTPHSEEDLQYICSENAW |
|||||||||
Kinase | AqueK122.AA | Pkinase | 134-179 | 17 | 7.239718 | 0.61 | Pfam | 209-276 (293) | Show / Hide |
Range on Protein: 134-179 Range on HMM: 209-276/293 Sequence Identity: 17% (12 aa) RPLYPGS----STINQLNRIMSTLPPPSRQDVESIKS-------------------PYAKAILDQIIHK ||..||. . ..|. .| ...|| . | . | . .| ... ...| RPPFPGHCWHDN-HDQMQMICRIMGPPLHFDWPWWCSISYFFFRHWHFHWTFHNWSEECKDFIKWCLCK |