Gene CAMK1c-S1_r (S.moellendorffii)
CAMK1c-S1_r
Species: S.moellendorffii
Alias: CAMK1c-S1_r
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CAMK1c-S1_r.AA | Protein | None | 724 | None | Fasta, JSON |
CAMK1c-S1_r.NA | RNA | None | 2175 | None | Fasta, JSON |
CAMK1c-S1_r.kin_dom | Protein Kinase Domain | None | 28 | None | Fasta, JSON |
Protein domains of CAMK1c-S1_r.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | CAMK1c-S1_r.AA | CAMK1 | 29-57 | 55 | 9.6e-15 | 39.22 | In-house | 248-276 (276) | Show / Hide |
Range on Protein: 29-57 Range on HMM: 248-276/276 Sequence Identity: 55% (16 aa) LAKDLMLGMLNLDKKKRLTAAQILEHPWI .|||. .||..| |||.|..|.|.|||| EAKDFIKHMLEVDPKKRYTCEQCLNHPWI |
|||||||||
Kinase | CAMK1c-S1_r.AA | DCAMKL | 23-57 | 48 | 1.2e-14 | 41.4 | In-house | 245-279 (279) | Show / Hide |
Range on Protein: 23-57 Range on HMM: 245-279/279 Sequence Identity: 48% (17 aa) WSRVPVLAKDLMLGMLNLDKKKRLTAAQILEHPWI |. . |||| ||. |..|| || ||..|||. WDNISDSAKDLISHMLQVDPEKRYTAEQIMQHPWV |
|||||||||
Kinase | CAMK1c-S1_r.AA | Aur | 24-57 | 47 | 4.4e-14 | 33.05 | In-house | 224-257 (257) | Show / Hide |
Range on Protein: 24-57 Range on HMM: 224-257/257 Sequence Identity: 47% (16 aa) SRVPVLAKDLMLGMLNLDKKKRLTAAQILEHPWI | .. ||||. . | | |.|.| .||..|||| SHISKEAKDLISKILQHDPKQRMTLDQIMNHPWI |
|||||||||
Kinase | CAMK1c-S1_r.AA | CAMK | 21-57 | 25 | 6.1e-14 | 40.6 | In-house | 366-425 (425) | Show / Hide |
Range on Protein: 21-57 Range on HMM: 366-425/425 Sequence Identity: 25% (15 aa) FDWSRVPV-----------------------LAKDLMLGMLNLDKKKRLTAAQILEHPWI |... .. .||| .||. | .||.|..|.|.|||. FPPPYFSPISCNYGPEWWDDISDEFHHFVSQECKDLIRKMLQVDPEKRMTIEQCLNHPWM |
|||||||||
Kinase | CAMK1c-S1_r.AA | CDPK | 22-57 | 47 | 3.2e-13 | 37.13 | In-house | 236-271 (271) | Show / Hide |
Range on Protein: 22-57 Range on HMM: 236-271/271 Sequence Identity: 47% (17 aa) DWSRVPVLAKDLMLGMLNLDKKKRLTAAQILEHPWI .|. . . |||| ||. | |||..|.|.|.|||. EWDHISDEAKDLIRKMLCYDPKKRMSAQQALQHPWF |
|||||||||
Kinase | CAMK1c-S1_r.AA | RAD53 | 22-57 | 44 | 1.1e-12 | 33.55 | In-house | 270-305 (305) | Show / Hide |
Range on Protein: 22-57 Range on HMM: 270-305/305 Sequence Identity: 44% (16 aa) DWSRVPVLAKDLMLGMLNLDKKKRLTAAQILEHPWI .|.|. |||| .||..| .||.|....| |||. YWDRISEEAKDLIKWMLCVDPEKRYTIDEALNHPWM |
|||||||||
Kinase | CAMK1c-S1_r.AA | Ciliate-E2a | 22-57 | 48 | 2.6e-12 | 32.59 | In-house | 239-275 (275) | Show / Hide |
Range on Protein: 22-57 Range on HMM: 239-275/275 Sequence Identity: 48% (18 aa) D-WSRVPVLAKDLMLGMLNLDKKKRLTAAQILEHPWI . |. .. .|||| .||. | |||.||.|.|.||| ECWEKCSKECKDLMKKMLEKDPKKRITAQQALNHPWF |
|||||||||
Kinase | CAMK1c-S1_r.AA | Ciliate-A9 | 29-57 | 41 | 1e-11 | 23.29 | In-house | 364-392 (392) | Show / Hide |
Range on Protein: 29-57 Range on HMM: 364-392/392 Sequence Identity: 41% (12 aa) LAKDLMLGMLNLDKKKRLTAAQILEHPWI .||.. . |.| . | .|.| | |||| NAKNFIQKMTNINPSNRYNAFQCLKHPWI |
|||||||||
Kinase | CAMK1c-S1_r.AA | MAPKAPK | 22-57 | 44 | 1.6e-11 | 31.51 | In-house | 257-292 (292) | Show / Hide |
Range on Protein: 22-57 Range on HMM: 257-292/292 Sequence Identity: 44% (16 aa) DWSRVPVLAKDLMLGMLNLDKKKRLTAAQILEHPWI .|| . |||| .|. | ..|||..|...|||| EWSHISEEAKDLIRKLLRRDPTQRLTIEQVMNHPWI |
|||||||||
Kinase | CAMK1c-S1_r.AA | AGC | 22-57 | 30 | 2.1e-11 | 24.25 | In-house | 350-395 (395) | Show / Hide |
Range on Protein: 22-57 Range on HMM: 350-395/395 Sequence Identity: 30% (14 aa) DWSRVPVLAKDLMLGMLNLDKKKRLT----------AAQILEHPWI ... . . ||||. ..|. | .|||. | .| .||| EDRWFSPEAKDLIKKLLCKDPEKRLGCGGNDFGDKGAEEIKNHPWF |
|||||||||
Kinase | CAMK1c-S1_r.AA | Pkinase | 30-57 | 53 | 2.2e-10 | 37.81 | Pfam | 266-293 (293) | Show / Hide |
Range on Protein: 30-57 Range on HMM: 266-293/293 Sequence Identity: 53% (15 aa) AKDLMLGMLNLDKKKRLTAAQILEHPWI .||.. ..|..| |||.||.|||.|||. CKDFIKWCLCKDPKKRPTAEQILQHPWF |
|||||||||
ZnF_C3H1 | CAMK1c-S1_r.AA | ZnF_C3H1 | 632-659 | 29 | 8e-06 | 26.67 | SMART | 1-31 (31) | Show / Hide |
Range on Protein: 632-659 Range on HMM: 1-31/31 Sequence Identity: 29% (9 aa) SSTPAVCKFF-LSG--DGCRYGAHCRYKHDS .. ...||.| . | |.||..|.. |. RYKTPPCKYFMRRGPPWYCPYGDRCKFAHPP |
|||||||||
Zf-CCCH | CAMK1c-S1_r.AA | zf-CCCH | 606-631 | 37 | 0.000134 | 19.25 | Pfam | 1-27 (27) | Show / Hide |
Range on Protein: 606-631 Range on HMM: 1-27/27 Sequence Identity: 37% (10 aa) DGKVQCVYFRR-GFCAKGNGCEFSHSV . . | ||.| |.| |. | |.|.. YKTELCRYFMRTGYCPYGDRCKFAHPQ |
|||||||||
ZnF_C3H1 | CAMK1c-S1_r.AA | ZnF_C3H1 | 606-631 | 38 | 0.000241 | 21.68 | SMART | 1-31 (31) | Show / Hide |
Range on Protein: 606-631 Range on HMM: 1-31/31 Sequence Identity: 38% (12 aa) DGK-VQCVYF-RRG---FCAKGNGCEFSHSV . | . | || ||| .| .|. | |.|. RYKTPPCKYFMRRGPPWYCPYGDRCKFAHPP |
|||||||||
Zf-CCCH | CAMK1c-S1_r.AA | zf-CCCH | 633-659 | 25 | 0.000285 | 18.14 | Pfam | 1-27 (27) | Show / Hide |
Range on Protein: 633-659 Range on HMM: 1-27/27 Sequence Identity: 25% (7 aa) STPAVCKFFLSGDGCRYGAHCRYKHDS . |..|. . |.||. |.. |. YKTELCRYFMRTGYCPYGDRCKFAHPQ |